{"product_id":"proteintech-21313-1-ap","title":"Proteintech, 21313-1-AP, FAM124B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM124B (21313-1-AP) by Proteintech is a Polyclonal antibody targeting FAM124B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21313-1-AP targets FAM124B in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM124B is identified as a novel component of CHD7 and CHD8 containing complex. It is a mainly nuclear localized protein with a widespread expressed. Fam124B is a novel protein possibly involved in the pathogenesis of CHARGE syndrome and neurodevelopmental disorders.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15963 Product name: Recombinant human FAM124B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-214 aa of BC025754 Sequence: MDETQGPLAMTVHLLANSGHGSLLQRTLDQLLDCICPEVRLFQVSERASPVKYCEKSHSKRSRFPGMSVLLFLHESPGEDRLFRVLDSLQHSPWQCYPTQDTRGRLCPYFFANQEFYSLDSQLPIWGVRQVHCGSEILRVTLYCSFDNYEDAIRLYEMILQREATLQKSNFCFFVLYASKSFALQLSLKQLPPGMSVDPKESSVLQFKVQEIGQ Predict reactive species\nFull Name: family with sequence similarity 124B\nCalculated Molecular Weight: 455 aa, 51 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC025754\nGene Symbol: FAM124B\nGene ID (NCBI): 79843\nRRID: AB_10859248\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H5Z6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869460418729,"sku":"21313-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21313-1-ap","provider":"Iright","version":"1.0","type":"link"}