{"product_id":"proteintech-21339-1-ap","title":"Proteintech, 21339-1-AP, RBM39 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBM39 (21339-1-AP) by Proteintech is a Polyclonal antibody targeting RBM39 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n21339-1-AP targets RBM39 in WB, IHC, IF\/ICC, RIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, human skeletal muscle tissue\nPositive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRBM39, also named as HCC1 or RNPC2, is a 530 amino acid protein, which contains three RRM (RNA recognition motif) domains and belongs to the splicing factor SR family. RBM39 is widely expressed in various tissues and with highly expression in pancreas, skeletal muscle, lung and brain. RBM39 is a transcriptional coactivator for steroid nuclear receptors ESR1\/ER-alpha and ESR2\/ER-beta, and JUN\/AP-1. RBM39 may be involved in pre-mRNA splicing process.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15584 Product name: Recombinant human RBM39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 328-530 aa of BC141835 Sequence: ERTDASSASSFLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR Predict reactive species\nFull Name: RNA binding motif protein 39\nCalculated Molecular Weight: 530 aa, 59 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC141835\nGene Symbol: RBM39\nGene ID (NCBI): 9584\nRRID: AB_10733352\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14498\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868908048553,"sku":"21339-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21339-1-ap","provider":"Iright","version":"1.0","type":"link"}