{"product_id":"proteintech-21346-1-ap","title":"Proteintech, 21346-1-AP, Sestrin 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Sestrin 2 (21346-1-AP) by Proteintech is a Polyclonal antibody targeting Sestrin 2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n21346-1-AP targets Sestrin 2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue, HEK-293 cells,  HeLa cells,  K-562 cells,  mouse lung tissue,  NIH\/3T3 cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSestrins, including sestrin-1 (PA26), sestrin-2 (Hi95), and sestrin-3, are 48 to 65 kDa cystein sulfinyl reductases and they modulate peroxide signaling and antioxidant defense. These proteins selectively reduce or repair hyperoxidized forms of typical 2-Cys peroxiredoxins within eukaryotes. Expression of these proteins is regulated by p53, a tumor suppressor protein. Sestrin 2 is implicated in the regulation of cell growth and survival, in cellular responses to different stress conditions, and also acts as a positive regulator of autophagy. Sestrin 2 is approximately a 57.6kDa protein (480 amino acids).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15669 Product name: Recombinant human SESN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of NM_031459 Sequence: MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESLEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAI Predict reactive species\nFull Name: sestrin 2\nCalculated Molecular Weight: 480 aa, 54 kDa\nObserved Molecular Weight: 60-66 kDa\nGenBank Accession Number: NM_031459\nGene Symbol: SESN2\/Sestrin 2\nGene ID (NCBI): 83667\nRRID: AB_10733238\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P58004\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868914634921,"sku":"21346-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21346-1-ap","provider":"Iright","version":"1.0","type":"link"}