{"product_id":"proteintech-21352-1-ap","title":"Proteintech, 21352-1-AP, SLC36A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC36A2 (21352-1-AP) by Proteintech is a Polyclonal antibody targeting SLC36A2 in WB, ELISA applications with reactivity to human, Mouse, Rat samples\n21352-1-AP targets SLC36A2 in WB, ELISA applications and shows reactivity with human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC36A2 encodes proton-coupled amino acid transporter 2 (PAT2), a high-affinity cotransporter of glycine and proline coupled with the uptake of a proton in kidney and muscles. The inactivation or reduced function of SLC36A2 is the predominant determinant of the inherited iminoglycinuria phenotype in humans.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, Mouse, Rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15742 Product name: Recombinant human SLC36A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC101101 Sequence: MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGT Predict reactive species\nFull Name: solute carrier family 36 (proton\/amino acid symporter), member 2\nCalculated Molecular Weight: 483 aa, 53 kDa\nObserved Molecular Weight: 53-60 kDa\nGenBank Accession Number: BC101101\nGene Symbol: SLC36A2\nGene ID (NCBI): 153201\nRRID: AB_3085653\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q495M3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887806271657,"sku":"21352-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21352-1-ap","provider":"Iright","version":"1.0","type":"link"}