{"product_id":"proteintech-21361-1-ap","title":"Proteintech, 21361-1-AP, LST1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LST1 (21361-1-AP) by Proteintech is a Polyclonal antibody targeting LST1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21361-1-AP targets LST1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLST1 (Leukocyte Specific Transcript 1), also known as B144, is a small adaptor protein expressed in leukocytes of myeloid lineage. LST1 splice variants (LST1\/A-LST1\/N) have been detected in various cell types, and  thought to affect mainly LST1 gene expression and splicing, are associated with inflammatory conditions(PMID: 10706707, PMID: 33986741). The molecular weight of LSTI protein may vary between different lysates.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15817 Product name: Recombinant human LST1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-66 aa of BC103856 Sequence: VKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT Predict reactive species\nFull Name: leukocyte specific transcript 1\nCalculated Molecular Weight: 97 aa, 11 kDa\nObserved Molecular Weight: 10-15 kDa\nGenBank Accession Number: BC103856\nGene Symbol: LST1\nGene ID (NCBI): 7940\nRRID: AB_2918071\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00453\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869705130153,"sku":"21361-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21361-1-ap","provider":"Iright","version":"1.0","type":"link"}