{"product_id":"proteintech-21383-1-ap","title":"Proteintech, 21383-1-AP, Pan-PAX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Pan-PAX (21383-1-AP) by Proteintech is a Polyclonal antibody targeting Pan-PAX in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n21383-1-AP targets Pan-PAX in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells, A2780 cells\nPositive IP detected in: SKOV-3 cells\nPositive IHC detected in: human ovary cancer tissue, human kidney tissue,  human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SKOV-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:600-1:2400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPAX genes encode a family of developmentally regulated transcription factors that have been implicated in a number of human and murine congenital disorders, as well as in tumorigenesis. These genes are defined by the presence of an evolutionarily conserved DNA binding domain, termed the paired domain. Many paired domain-containing proteins recognize a common sequence motif. The immunogen of this atnibody is the Paired box domain of PAX family. This antibody is a Pan-PAX antibody.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16018 Product name: Recombinant human pan-PAX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-140 aa of BC001060 Sequence: HGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF Predict reactive species\nFull Name: paired box 8\nCalculated Molecular Weight: 450 aa, 48 kDa\nObserved Molecular Weight: 36-48 kDa\nGenBank Accession Number: BC001060\nGene Symbol: PAX8\nGene ID (NCBI): 7849\nRRID: AB_10733094\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q06710\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868971454633,"sku":"21383-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21383-1-ap","provider":"Iright","version":"1.0","type":"link"}