{"product_id":"proteintech-21391-1-ap","title":"Proteintech, 21391-1-AP, ALDH1L2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALDH1L2 (21391-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH1L2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21391-1-AP targets ALDH1L2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue, rat pancreas tissue\nPositive IHC detected in: human pancreas tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nALDH1L2(Aldehyde dehydrogenase family 1 member L2) is also named as mitochondrial 10-FTHFDH, mtFDH and belongs to the aldehyde dehydrogenase family and ALDH1L subfamily. The ALDH1L2 gene has three transcriptional variants with the molecular weight of 102 kDa, 42 kDa and 89 kDa(PMID:19823103). It is a mitochondrial enzyme, a likely source of CO2 production from 10-formyltetrahydrofolate in mitochondria and playing an essential role in the distribution of one-carbon groups between the cytosolic and mitochondrial compartments of the cell(PMID: 20498374). It also has dehydrogenase\/hydrolase activities similar to cytosolic FDH (ALDH1L1). The native ALDH1L2 has been reported to exist as a dimer or tetramer(PMID:7822273).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16046 Product name: Recombinant human ALDH1L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC103935 Sequence: MVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVLFGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVPIIEDS Predict reactive species\nFull Name: aldehyde dehydrogenase 1 family, member L2\nCalculated Molecular Weight: 923 aa, 102 kDa\nObserved Molecular Weight: 102 kDa, 89 kDa\nGenBank Accession Number: BC103935\nGene Symbol: ALDH1L2\nGene ID (NCBI): 160428\nRRID: AB_2878854\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q3SY69\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868915519657,"sku":"21391-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21391-1-ap","provider":"Iright","version":"1.0","type":"link"}