{"product_id":"proteintech-21392-1-ap","title":"Proteintech, 21392-1-AP, NCKAP5L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NCKAP5L (21392-1-AP) by Proteintech is a Polyclonal antibody targeting NCKAP5L in WB, IHC, ELISA applications with reactivity to human samples\n21392-1-AP targets NCKAP5L in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNCKAP5L, also named as KIAA1602, has 4 isoforms. The target band is about 139-145 kDa for phosphorylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16050 Product name: Recombinant human KIAA1602 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-61 aa of BC110599 Sequence: MDQPAGGPGNPRPGEGDDGSMEPGTCQELLHRLRELEAENSALAQANENQRETYERCLDEV Predict reactive species\nFull Name: KIAA1602\nCalculated Molecular Weight: 1334 aa, 139 kDa\nObserved Molecular Weight: 145-150 kDa\nGenBank Accession Number: BC110599\nGene Symbol: NCKAP5L\nGene ID (NCBI): 57701\nRRID: AB_10860259\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HCH0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887733526697,"sku":"21392-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21392-1-ap","provider":"Iright","version":"1.0","type":"link"}