{"product_id":"proteintech-21430-1-ap","title":"Proteintech, 21430-1-AP, SLC24A6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC24A6 (21430-1-AP) by Proteintech is a Polyclonal antibody targeting SLC24A6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21430-1-AP targets SLC24A6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC24A6, also named as NCLX, is a kind of mitochondrial sodium\/calcium antiporter that mediates sodium-dependent calcium efflux from mitochondrion by mediating the exchange of 3 sodium ions per 1 calcium ion. It has been reported that SLC24A6 plays a key role in attenuating potential ROS production and injury upon cardiac reperfusion. SLC24A6 is associated with mitochondrial calcium homeostasis by mediating mitochondrial calcium extrusion. (PMID: 32728214, 20018762, 28219928)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16034 Product name: Recombinant human SLC24A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-333 aa of BC098360 Sequence: YVVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKALKVFKLP Predict reactive species\nFull Name: solute carrier family 24 (sodium\/potassium\/calcium exchanger), member 6\nCalculated Molecular Weight: 584 aa, 64 kDa\nObserved Molecular Weight: 64 kDa\nGenBank Accession Number: BC098360\nGene Symbol: SLC24A6\nGene ID (NCBI): 80024\nRRID: AB_10858637\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6J4K2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868936917161,"sku":"21430-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21430-1-ap","provider":"Iright","version":"1.0","type":"link"}