{"product_id":"proteintech-21433-1-ap","title":"Proteintech, 21433-1-AP, SLC5A8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC5A8 (21433-1-AP) by Proteintech is a Polyclonal antibody targeting SLC5A8 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n21433-1-AP targets SLC5A8 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, human brain tissue,  mouse brain tissue,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: rat kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe sodium-coupled monocarboxylate transporter 1 (SMCT1; SLC5A8), belonging to the SLC5A family, is a 67-kDa protein that functions as a Na+-coupled electrogenic transporter for SCFAs. SLC5A mRNA and protein are expressed in healthy human, rat, and mouse colon. The protein is localized to the apical membrane of the colonocytes. Immunohistochemical studies revealed the selective localization of SMCT1 on the brush border in the villi of the terminal ileum and crypts of the colon in mice.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16041 Product name: Recombinant human SLC5A8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 531-610 aa of BC110492 Sequence: VTLLVGILVSLSTGGRKQNLDPRYILTKEDFLSNFDIFKKKKHVLSYKSHPVEDGGTDNPAFNHIELNSDQSGKSNGTRL Predict reactive species\nFull Name: solute carrier family 5 (iodide transporter), member 8\nCalculated Molecular Weight: 610 aa, 67 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: BC110492\nGene Symbol: SLC5A8\nGene ID (NCBI): 160728\nRRID: AB_10755299\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N695\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868908703913,"sku":"21433-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21433-1-ap","provider":"Iright","version":"1.0","type":"link"}