{"product_id":"proteintech-21460-1-ap","title":"Proteintech, 21460-1-AP, PRH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRH1 (21460-1-AP) by Proteintech is a Polyclonal antibody targeting PRH1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n21460-1-AP targets PRH1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRH1, also known as Salivary acidic proline-rich phosphoprotein 1\/2, is a 166 amino acid secreted protein whose molecular weight is 17 kDa. It functions as a highly potent inhibitor of calcium phosphate crystal growth. Similar to other PRPs, PRH1 provides a protective and reparative environment for dental enamel, which is important for teeth integrity. This antibody specifically recognises the 17 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14833 Product name: Recombinant human PRH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 17-187 aa of BC064553 Sequence: QDLNEDVSQEDVPLVISDGGDSEQFLDEERQGPPLGGQQSQPSAGDGNQDDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ Predict reactive species\nFull Name: proline-rich protein HaeIII subfamily 1\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC064553\nGene Symbol: PRH1\nGene ID (NCBI): 5554\nRRID: AB_2878862\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02810\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887773307049,"sku":"21460-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21460-1-ap","provider":"Iright","version":"1.0","type":"link"}