{"product_id":"proteintech-21516-1-ap","title":"Proteintech, 21516-1-AP, LHX6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LHX6 (21516-1-AP) by Proteintech is a Polyclonal antibody targeting LHX6 in WB, ELISA applications with reactivity to human samples\n21516-1-AP targets LHX6 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLHX6 is a LIM homeodomain protein similar in structure to ISL-1. LHX6, like ISL-1, contains tandem LIM domains and a homeodomain that regulate its activity both in cis and through interaction with cell-specific factors. LHX6 is highly expressed in the neural crest-derived mesenchyme throughout odontogenesis and down-regulated after birth. However, LHX6 is also expressed in the palate, oral, and dental epithelium during craniofacial development. LHX6 regulates the migration and specification of neuron subtypes and marks specific neurons. The molecular weight of Endogenous LHX6 is 40 kDa, but the LHX6-PITX2 protein complex is 56 kDa (PMID: 23229549).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16047 Product name: Recombinant human LHX6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 276-363 aa of BC103937 Sequence: KHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY Predict reactive species\nFull Name: LIM homeobox 6\nCalculated Molecular Weight: 392 aa, 43 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC103937\nGene Symbol: LHX6\nGene ID (NCBI): 26468\nRRID: AB_2878875\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UPM6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869554856105,"sku":"21516-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21516-1-ap","provider":"Iright","version":"1.0","type":"link"}