{"product_id":"proteintech-21519-1-ap","title":"Proteintech, 21519-1-AP, Frizzled 5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Frizzled 5 (21519-1-AP) by Proteintech is a Polyclonal antibody targeting Frizzled 5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21519-1-AP targets Frizzled 5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  COLO 320 cells,  Jurkat cells,  PC-3 cells,  mouse lung tissue,  PC-12 cells,  mouse colon tissue,  mouse small intestine tissue,  rat colon tissue\nPositive IHC detected in: human stomach cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFzd5, is the receptor for the Wnt5A ligand. Fzd5 modulates cell fate and cell behavior during vertebrate development. It regulates hematopoiesis by the antagonism of the canonical Wnt pathway, resulting in a pool of quiescent hematopoietic stem cells, and regulates hematopoietic stem cell function in a paracrine fashion through several distinct mechanisms including modulating canonical Wnt signaling. It acts through noncanonical Wnt signaling to promote angiogenesis. It is also involved in control cell orientation, polarity, and directional movement in response to positional cues from chemokine gradients.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16082 Product name: Recombinant human FZD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 524-585 aa of BC114346 Sequence: GKTVESWRRFTSRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSHV Predict reactive species\nFull Name: frizzled homolog 5 (Drosophila)\nCalculated Molecular Weight: 585 aa, 65 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC114346\nGene Symbol: FZD5\nGene ID (NCBI): 7855\nRRID: AB_2878877\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13467\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869542928553,"sku":"21519-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21519-1-ap","provider":"Iright","version":"1.0","type":"link"}