{"product_id":"proteintech-21541-1-ap","title":"Proteintech, 21541-1-AP, FCGR2B \/ CD32b Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FCGR2B \/ CD32b (21541-1-AP) by Proteintech is a Polyclonal antibody targeting FCGR2B \/ CD32b in WB, IHC, ELISA applications with reactivity to human samples\n21541-1-AP targets FCGR2B \/ CD32b in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue,  Raji cells\nPositive IHC detected in: human tonsillitis tissue, human placenta tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16189 Product name: Recombinant human FCGR2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 254-310 aa of BC031992 Sequence: ALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI Predict reactive species\nFull Name: Fc fragment of IgG, low affinity IIb, receptor (CD32)\nCalculated Molecular Weight: 310 aa, 34 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC031992\nGene Symbol: CD32b\nGene ID (NCBI): 2213\nRRID: AB_2878881\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31994\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869682913449,"sku":"21541-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21541-1-ap","provider":"Iright","version":"1.0","type":"link"}