{"product_id":"proteintech-21544-1-ap","title":"Proteintech, 21544-1-AP, ZEB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZEB1 (21544-1-AP) by Proteintech is a Polyclonal antibody targeting ZEB1 in WB, IP, ELISA applications with reactivity to human, mouse samples\n21544-1-AP targets ZEB1 in WB, IHC, IF, IP, CoIP, chIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, MCF-7 cells,  PC-3 cells,  COLO 320 cells,  MDA-MB-453s cells,  mouse colon tissue\nPositive IP detected in: COLO 320 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZEB1(zinc-finger-enhancer binding protein 1), which is a member of the Zinc finger-Homeobox (ZFH) family of repressors, acts as a transcriptional repressor that inhibits interleukin-2 (IL-2) gene expression. Depending on the quantity of cDNA and on the cell type, ZEB1 can enhance or repress the promoter activity of the ATP1A1 gene. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4\/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. The calculated molecular weight of ZEB1 is 124 kDa, but the post-phosphorylation of protein is about 190-210 kDa. This is a rabbit polyclonal antibody raised against part of the full length of ZEB1 of human.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16204 Product name: Recombinant human ZEB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 391-740 aa of BC112392 Sequence: MVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSL Predict reactive species\nFull Name: zinc finger E-box binding homeobox 1\nCalculated Molecular Weight: 1125 aa, 124 kDa\nObserved Molecular Weight: 190-210 kDa\nGenBank Accession Number: BC112392\nGene Symbol: ZEB1\nGene ID (NCBI): 6935\nRRID: AB_10734325\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P37275\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868822032553,"sku":"21544-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21544-1-ap","provider":"Iright","version":"1.0","type":"link"}