{"product_id":"proteintech-21574-1-ap","title":"Proteintech, 21574-1-AP, TNFR1\/CD120a Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TNFR1\/CD120a (21574-1-AP) by Proteintech is a Polyclonal antibody targeting TNFR1\/CD120a in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n21574-1-AP targets TNFR1\/CD120a in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, HL-60 cells,  human brain tissue,  HeLa cells\nPositive IHC detected in: mouse brain tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTumor necrosis factor (TNF) is a multifunctional cytokine that plays a key role in regulating inflammation, immune functions, host defense, and apoptosis (PMID: 16407280). TNF exists in soluble and membrane-bound forms. TNF signals through two distinct cell surface receptors, TNFR1 (TNFRSF1A, CD120a) and TNFR2 (TNFRSF1B, CD120b). Whereas TNFR1 is widely expressed, expression of TNFR2 is limited to cells of the immune system, endothelial cells, and nerve cells (PMID: 22053109). TNFR1, which contains a death domain (DD) within its intracytoplasmic region, is thought to be the key receptor for TNF signaling (PMID: 16407280). This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4\/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16112 Product name: Recombinant human TNFR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 235-455 aa of BC010140 Sequence: RYQRWKSKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYTPGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 1A\nCalculated Molecular Weight: 455 aa, 50 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC010140\nGene Symbol: TNFR1\nGene ID (NCBI): 7132\nRRID: AB_10734433\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P19438\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868833435817,"sku":"21574-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21574-1-ap","provider":"Iright","version":"1.0","type":"link"}