{"product_id":"proteintech-21586-1-ap","title":"Proteintech, 21586-1-AP, CHRNA7\/CHRFAM7A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHRNA7\/CHRFAM7A (21586-1-AP) by Proteintech is a Polyclonal antibody targeting CHRNA7\/CHRFAM7A in WB, ELISA applications with reactivity to human samples\n21586-1-AP targets CHRNA7\/CHRFAM7A in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuronal acetylcholine receptor subunit alpha-7, encoded by the CHRNA7 gene, is involved in cognition through interneuron modulation of 4-(2-aminoethyl)benzene-1,2-diol and glutamate signaling. CHRNA7 gene is genetically linked to multiple disorders with cognitive deficits. A partial duplication of CHRNA7 (CHRFAM7A) is found in humans. CHRFAM7A gene encodes the CHRNA7-FAM7A fusion protein. Expression of CHRFAM7A has been reported in brain, peripheral blood lymphocytes (PBLs), and a broad range of epithelial cells (PMID: 21718690; 23553139; 25681457). CHRFAM7A has been associated with many neuropsychiatric disorders (PMID: 25906356; 25701707). This antibody, raised against 241-386 amino acids of human CHRFAM7A protein, recognizes both CHRNA7 and CHRFAM7A.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16151 Product name: Recombinant human CHRFAM7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 241-386 aa of BC101348 Sequence: TRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFS Predict reactive species\nFull Name: CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion\nCalculated Molecular Weight: 412 aa, 46 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC101348\nGene Symbol: CHRNA7\/CHRFAM7A\nGene ID (NCBI): 89832\nRRID: AB_10734326\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q494W8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886542737577,"sku":"21586-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21586-1-ap","provider":"Iright","version":"1.0","type":"link"}