{"product_id":"proteintech-21595-1-ap","title":"Proteintech, 21595-1-AP, PTGFR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTGFR (21595-1-AP) by Proteintech is a Polyclonal antibody targeting PTGFR in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21595-1-AP targets PTGFR in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, mouse brain tissue,  rat brain tissue\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProstanoid FP receptor(PTGFR) is a member of the G-protein coupled receptor family and is involved in several physiologic processes. PTGFR is a receptor for prostaglandin F2-alpha (PGF2-alpha), which is known to be a potent luteolytic agent, and may also be involved in modulating intraocular pressure and smooth muscle contraction in the uterus(PMID: 9235889).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16173 Product name: Recombinant human PTGFR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 305-359 aa of BC112965 Sequence: ILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISESPVAEKSAST Predict reactive species\nFull Name: prostaglandin F receptor (FP)\nCalculated Molecular Weight: 359 aa, 40 kDa\nObserved Molecular Weight: 30-40 kDa\nGenBank Accession Number: BC112965\nGene Symbol: PTGFR\nGene ID (NCBI): 5737\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P43088\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887776714921,"sku":"21595-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21595-1-ap","provider":"Iright","version":"1.0","type":"link"}