{"product_id":"proteintech-21655-1-ap","title":"Proteintech, 21655-1-AP, CDX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDX1 (21655-1-AP) by Proteintech is a Polyclonal antibody targeting CDX1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n21655-1-AP targets CDX1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, mouse small intestine tissue,  mouse stomach tissue,  mouse colon tissue,  rat colon tissue\nPositive IP detected in: Caco-2 cells\nPositive IHC detected in: human colon cancer tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Caco-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16376 Product name: Recombinant human CDX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-154 aa of BC096252 Sequence: KQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP Predict reactive species\nFull Name: caudal type homeobox 1\nCalculated Molecular Weight: 265 aa, 28 kDa\nObserved Molecular Weight: 28-35 kDa\nGenBank Accession Number: BC096252\nGene Symbol: CDX1\nGene ID (NCBI): 1044\nRRID: AB_2878901\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P47902\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886415859881,"sku":"21655-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21655-1-ap","provider":"Iright","version":"1.0","type":"link"}