{"product_id":"proteintech-21662-1-ap","title":"Proteintech, 21662-1-AP, ATP5G3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP5G3 (21662-1-AP) by Proteintech is a Polyclonal antibody targeting ATP5G3 in IHC, ELISA applications with reactivity to human samples\n21662-1-AP targets ATP5G3 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP5G3, also known as ATP5MC3, belongs to the ATPase C chain family. ATP5G3 encodes subunit 9 (ATPase subunit c), which is a subunit of the multi-subunit enzyme that catalyzes ATP synthesis during oxidative phosphorylation in mitochondria. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The subunit c is a component of the proton channel proteins in the F0 portion of the enzyme.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16406 Product name: Recombinant human ATP5G3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC106881 Sequence: MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREF Predict reactive species\nFull Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9)\nCalculated Molecular Weight: 142 aa, 15 kDa\nGenBank Accession Number: BC106881\nGene Symbol: ATP5G3\nGene ID (NCBI): 518\nRRID: AB_3085665\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48201\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885116674217,"sku":"21662-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21662-1-ap","provider":"Iright","version":"1.0","type":"link"}