{"product_id":"proteintech-21679-1-ap","title":"Proteintech, 21679-1-AP, NANOS3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NANOS3 (21679-1-AP) by Proteintech is a Polyclonal antibody targeting NANOS3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21679-1-AP targets NANOS3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, HEK-293 cells\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe NANOS gene family is required for germ cell development in diverse organisms. NANOS3 is found in migrating primordial germ cells, and the homozygous deficiency of NANOS3 in the mouse results in the complete loss of germ cells in both sexes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16014 Product name: Recombinant human NANOS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC101209 Sequence: MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATRERAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKTQDTGHRRGGGGGAGFRGAGKSEPSPSCSPSMST Predict reactive species\nFull Name: nanos homolog 3 (Drosophila)\nCalculated Molecular Weight: 192 aa, 21 kDa\nObserved Molecular Weight: 26-30 kDa\nGenBank Accession Number: BC101209\nGene Symbol: NANOS3\nGene ID (NCBI): 342977\nRRID: AB_10859250\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P60323\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868984987817,"sku":"21679-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21679-1-ap","provider":"Iright","version":"1.0","type":"link"}