{"product_id":"proteintech-21685-1-ap","title":"Proteintech, 21685-1-AP, Trehalase Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Trehalase (21685-1-AP) by Proteintech is a Polyclonal antibody targeting Trehalase in WB, IF-P, ELISA applications with reactivity to human, mouse samples\n21685-1-AP targets Trehalase in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse small intestine tissue\nPositive IF-P detected in: human kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTrehalase is the enzyme hydrolyzing trehalose and belongs to the glycosyl hydrolase 37 family. In humans and most mammals, trehalase is found in the brush borders of the intestinal mucosa, kidney, liver, and blood plasma. Trehalases are conserved enzymes that catalyze the hydrolysis of one of two glycoside bonds of trehalose. With the exception of vertebrates where trehalase is required for the degradation of ingested trehalose, in other animal groups it is involved in diverse physiological processes including carbohydrate metabolism, resumption of growth in certain resting cells, germination of spores in fungi, recovery from stress conditions, etc (PMID: 25429048, PMID: 30628830).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16246 Product name: Recombinant human TREH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 203-552 aa of BC109206 Sequence: YLTHTNDTAFLQENIETLALELDFWTKNRTVSVSLEGKNYLLNRYYVPYGGPRPESYSKDVELADTLPEGDREALWAELKAGAESGWDFSSRWLIGGPNPNSLSGIRTSKLVPVDLNAFLCQAEELMSNFYSRLGNDSQATKYRILRSQRLAALNTVLWDEQTGAWFDYDLEKKKKNREFYPSNLTPLWAGCFSDPGVADKALKYLEDNRILTYQYGIPTSLQKTGQQWDFPNAWAPLQDLVIRGLAKAPLRRAQEVAFQLAQNWIRTNFDVYSQKSAMYEKYDVSNGGQPGGGGEYEVQEGFGWTNGVVLMLLDRYGDRLTSGAKLAFLEPHCLAATLLPSLLLSLLPW Predict reactive species\nFull Name: trehalase (brush-border membrane glycoprotein)\nCalculated Molecular Weight: 583 aa, 67 kDa\nObserved Molecular Weight: 67-70 kDa\nGenBank Accession Number: BC109206\nGene Symbol: Trehalase\nGene ID (NCBI): 11181\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: O43280\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869780758697,"sku":"21685-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21685-1-ap","provider":"Iright","version":"1.0","type":"link"}