{"product_id":"proteintech-21725-1-ap","title":"Proteintech, 21725-1-AP, Cytokeratin 2e Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytokeratin 2e (21725-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 2e in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21725-1-AP targets Cytokeratin 2e in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse skin tissue,  rat skin tissue.\nPositive IHC detected in: human cervical cancer tissue, human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKeratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells. Keratin expression is highly regulated, tissue specific, and varies according to cell-state. Type I keratins consist of acidic, low molecular weight proteins with MW ranging from 40 kDa (KRT19) to 64 kDa (KRT9). Type 2 keratins consist of basic or neutral, high molecular weight proteins  with MW from 52 kDa (KRT8) to 67 kDa (KRT18).Keratin 2 is a type II cytokeratin. It is found largely in the upper spinous layer of epidermal keratinocytes, and also in other regions, notably the epidermis covering the knee, thigh, and groin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16384 Product name: Recombinant human KRT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 210-331 aa of BC096294 Sequence: WELLQQMNVGTRPINLEPIFQGYIDSLKRYLDGLTAERTSQNSELNNMQDLVEDYKKKYEDEINKRTAAENDFVTLKKDVDNAYMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQSVTDT Predict reactive species\nFull Name: keratin 2\nCalculated Molecular Weight: 639 aa, 66 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC096294\nGene Symbol: KRT2\nGene ID (NCBI): 3849\nRRID: AB_2878914\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35908\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869671084201,"sku":"21725-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21725-1-ap","provider":"Iright","version":"1.0","type":"link"}