{"product_id":"proteintech-21737-1-ap","title":"Proteintech, 21737-1-AP, CDH9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDH9 (21737-1-AP) by Proteintech is a Polyclonal antibody targeting CDH9 in WB, ELISA applications with reactivity to human samples\n21737-1-AP targets CDH9 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDH9, also known as Cadherin 9, is a type of cadherin that plays a significant role in cell adhesion and tissue organization. It is a member of the cadherin superfamily, which is a group of transmembrane glycoproteins that mediate cell-cell adhesion. (PMID: 36315446)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16437 Product name: Recombinant human CDH9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 469-541 aa of BC113745 Sequence: SSHIPVFIRILDINDHAPEFAMYYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFFFEPVPEFTLNPNFTIVD Predict reactive species\nFull Name: cadherin 9, type 2 (T1-cadherin)\nCalculated Molecular Weight: 789 aa, 89 kDa\nObserved Molecular Weight: 107 kDa\nGenBank Accession Number: BC113745\nGene Symbol: CDH9\nGene ID (NCBI): 1007\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULB4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886395478185,"sku":"21737-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21737-1-ap","provider":"Iright","version":"1.0","type":"link"}