{"product_id":"proteintech-21741-1-ap","title":"Proteintech, 21741-1-AP, CARD11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CARD11 (21741-1-AP) by Proteintech is a Polyclonal antibody targeting CARD11 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21741-1-AP targets CARD11 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, mouse thymus tissue\nPositive IHC detected in: human colon cancer tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCARD11 also named as ,BIMP3 or CARMA1, is a 1154 amino acid protein, which contains one PDZ domain, one guanylate kinase-like domain, and one CARD domain. CARD11 localizes in the cytoplasm and co-localized with DPP4 in membrane raft. CARD11 is detected in adult peripheral blood leukocytes, thymus, spleen and liver. CARD11 also is found in CARD11 promyelocytic leukemia HL-60 cells, chronic myelogenous leukemia K-562 cells, Burkitt's lymphoma Raji cells and colorectal adenocarcinoma SW480 cells. CARD11 is involved in the co-stimulatory signal essential for T-cell receptor mediated T-cell activation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16468 Product name: Recombinant human CARD11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 798-1147 aa of BC111719 Sequence: DTMYQDRHEWLCARVDPFTDHDLDMGTIPSYSRAQQLLLVKLQRLMHRGSREEVDGTHHTLRALRNTLQPEEALSTSDPRVSPRLSRASFLFGQLLQFVSRSENKYKRMNSNERVRIISGSPLGSLARSSLDATKLLTEKQEELDPESELGKNLSLIPYSLVRAFYCERRRPVLFTPTVLAKTLVQRLLNSGGAMEFTICKSDIVTRDEFLRRQKTETIIYSREKNPNAFECIAPANIEAVAAKNKHCLLEAGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATVEPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL Predict reactive species\nFull Name: caspase recruitment domain family, member 11\nCalculated Molecular Weight: 1154 aa, 133 kDa\nObserved Molecular Weight: 133 kDa\nGenBank Accession Number: BC111719\nGene Symbol: CARD11\nGene ID (NCBI): 84433\nRRID: AB_2878915\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BXL7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868993933481,"sku":"21741-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21741-1-ap","provider":"Iright","version":"1.0","type":"link"}