{"product_id":"proteintech-21754-1-ap","title":"Proteintech, 21754-1-AP, PDE4C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDE4C (21754-1-AP) by Proteintech is a Polyclonal antibody targeting PDE4C in WB, ELISA applications with reactivity to human, mouse samples\n21754-1-AP targets PDE4C in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDE4C(cAMP-specific 3,5-cyclic phosphodiesterase 4C) is also named as DPDE1 and belongs to the PDE4 subfamily, which play a key role in lung inflammation and hyperresponsiveness. PDE4C promotes the hydrolysis of cAMP, and PKD2, functioning as a Ca2+ entry channel, may mediate local accumulation of Ca2+ that inhibits the activity of Ca2+-sensitive ADCY5(PMID:21670265). The three isoforms(84,75, and 64 kDa) of PDE4C have been detected in cytosolic, microsomal, and nuclear (PMID:21784969).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16130 Product name: Recombinant human PDE4C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-91 aa of BC109067 Sequence: EYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSASLSSATVPRFGVQTDQEEQLAK Predict reactive species\nFull Name: phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila)\nCalculated Molecular Weight: 712 aa, 80 kDa\nObserved Molecular Weight: ~70 kDa\nGenBank Accession Number: BC109067\nGene Symbol: PDE4C\nGene ID (NCBI): 5143\nRRID: AB_10860265\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q08493\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868971684009,"sku":"21754-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21754-1-ap","provider":"Iright","version":"1.0","type":"link"}