{"product_id":"proteintech-21768-1-ap","title":"Proteintech, 21768-1-AP, FAM117B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM117B (21768-1-AP) by Proteintech is a Polyclonal antibody targeting FAM117B in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n21768-1-AP targets FAM117B in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  mouse kidney tissue,  rat kidney tissue\nPositive IP detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM117B, also named as ALS2CR13, is mapped in the genomic region covering the complete candidate region for Amyotrophic lateral sclerosis 2 (ALS2). This antibody is specific to FAM117B.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16407 Product name: Recombinant human FAM117B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 49-128 aa of BC106906 Sequence: SKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKETGEKEEQLIPQDI Predict reactive species\nFull Name: family with sequence similarity 117, member B\nCalculated Molecular Weight: 589 aa, 62 kDa\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: BC106906\nGene Symbol: FAM117B\nGene ID (NCBI): 150864\nRRID: AB_10804757\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6P1L5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869460287657,"sku":"21768-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21768-1-ap","provider":"Iright","version":"1.0","type":"link"}