{"product_id":"proteintech-21848-1-ap","title":"Proteintech, 21848-1-AP, CHT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHT1 (21848-1-AP) by Proteintech is a Polyclonal antibody targeting CHT1 in WB, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n21848-1-AP targets CHT1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IP detected in: mouse heart tissue\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16136 Product name: Recombinant human SLC5A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 457-580 aa of BC111525 Sequence: QPLIFYPGYYPDDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ Predict reactive species\nFull Name: solute carrier family 5 (choline transporter), member 7\nCalculated Molecular Weight: 580 aa, 63 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC111525\nGene Symbol: CHT1\nGene ID (NCBI): 60482\nRRID: AB_2878925\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9GZV3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869453078697,"sku":"21848-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21848-1-ap","provider":"Iright","version":"1.0","type":"link"}