{"product_id":"proteintech-21851-1-ap","title":"Proteintech, 21851-1-AP, CD11b Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD11b (21851-1-AP) by Proteintech is a Polyclonal antibody targeting CD11b in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n21851-1-AP targets CD11b in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: TF-1 cells\nPositive IHC detected in: human tonsillitis tissue, Insulinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntegrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits (PMID: 9779984). CD11b, also known as Integrin alpha M or CR3A, belongs to the integrin alpha chain family. CD11b forms an α\/β heterodimer with CD18 (integrin β2). CD11b\/CD18 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles and pathogens (PMID: 9558116; 20008295). CD11b\/CD18 is a receptor for the complement protein fragment iC3b, and is also a receptor for fibrinogen, factor X and ICAM1 (PMID: 2971974; 15485828).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16327 Product name: Recombinant human CD11B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 127-320 aa of BC096346 Sequence: GSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEA Predict reactive species\nFull Name: integrin, alpha M (complement component 3 receptor 3 subunit)\nCalculated Molecular Weight: 1152 aa, 127 kDa\nObserved Molecular Weight: 170 kDa\nGenBank Accession Number: BC096346\nGene Symbol: CD11b\nGene ID (NCBI): 3684\nENSEMBL Gene ID: ENSG00000169896\nRRID: AB_2878927\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11215\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868847984809,"sku":"21851-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21851-1-ap","provider":"Iright","version":"1.0","type":"link"}