{"product_id":"proteintech-21857-1-ap","title":"Proteintech, 21857-1-AP, SAFB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SAFB (21857-1-AP) by Proteintech is a Polyclonal antibody targeting SAFB in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n21857-1-AP targets SAFB in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells,  HeLa cells,  MCF-7 cells,  A431 cells,  HCT 116 cells,  COLO 320 cells\nPositive IHC detected in: mouse testis tissue, human testis tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHeterogeneous nuclear ribonucleoproteins (hnRNPs) constitute a set of polypeptides that contribute to pre-mRNA processing and transport. hnRNPs also bind heterogeneous nuclear RNA (hnRNA), the transcripts produced by RNA polymerase II. SAFB (scaffold attachment factor B) is a nuclear matrix-associated protein that binds to matrix- or scaffold-associating regions (MARs or SARs) on DNA and interacts with RNA polymerase II and serine-\/arginine-rich RNA processing factors (SR proteins). SAFB, also designated HAP (hnRNP A1 associated protein) and HET (HSP 27-ERE-TATA-binding protein) is a proven hnRNP protein that has a speckled distribution in the nucleus and, in response to stress agents such as heat shock, is recruited to a few, large nuclear granules, called perichromatin granules. SAFB also binds to the estrogen receptor (ER) and is expressed in several breast cancer cell lines at varying levels. Subsequently, SAFB may play a role in breast cancer by mediating cellular proliferation and division. This antibody specifically reacts whith the isoform 1 of human SAFB protein. SF3A1, also known as SF3a120, is a 793 amino acid protein, which is a Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. SF3A1 also be involved in the assembly of the 'E' complex. The calculated molecular weight of SAFB is 103 kDa, but the modified SAFB is about 130-175 kDa.(PMID: 28469965, PMID: 26273616 )\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16451 Product name: Recombinant human SAFB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 58-213 aa of BC126219 Sequence: MERLKKAIEDEGGNPDEIEITSEGNKKTSKRSSKGRKPEEEGVEDNGLEENSGDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFTILQEIEEPSLEPE Predict reactive species\nFull Name: scaffold attachment factor B\nCalculated Molecular Weight: 917 aa, 103 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: BC126219\nGene Symbol: SAFB\nGene ID (NCBI): 6294\nRRID: AB_2878928\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15424\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869428437161,"sku":"21857-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21857-1-ap","provider":"Iright","version":"1.0","type":"link"}