{"product_id":"proteintech-21865-1-ap","title":"Proteintech, 21865-1-AP, IL-6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-6 (21865-1-AP) by Proteintech is a Polyclonal antibody targeting IL-6 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n21865-1-AP targets IL-6 in WB, IHC, IF\/ICC, IP, Neutralization, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LPS and Protein transport inhibitor treated HUVEC cells\nPositive IP detected in: LPS and Protein transport inhibitor treated HUVEC cells\nPositive IF\/ICC detected in: LPS and Brefeldin A treated HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. IL-6 plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. IL-6 is also considered a myokine, a cytokine produced from muscle, and is elevated in response to muscle contraction. IL-6 has been shown to interact with interleukin-6 receptor and glycoprotein 130. Additionally, IL-6 is involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig, rabbit, canine, bovine, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10565 Product name: Recombinant human IL-6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC015511 Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Predict reactive species\nFull Name: interleukin 6 (interferon, beta 2)\nCalculated Molecular Weight: 212 aa, 24 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC015511\nGene Symbol: IL6\nGene ID (NCBI): 3569\nENSEMBL Gene ID: ENSG00000136244\nRRID: AB_11142677\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05231\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868818264233,"sku":"21865-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21865-1-ap","provider":"Iright","version":"1.0","type":"link"}