{"product_id":"proteintech-21875-1-ap","title":"Proteintech, 21875-1-AP, EphA4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EphA4 (21875-1-AP) by Proteintech is a Polyclonal antibody targeting EphA4 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n21875-1-AP targets EphA4 in WB, IHC, IF\/ICC, IP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Neuron cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEphA4 is a member of the Eph receptor tyrosine kinase family and has important functions in the developing and adult nervous system (PMID: 14697664). The Eph receptors comprise a large family of closely related transmembrane tyrosine kinases that actively signal when bound to their ephrin ligands. The Eph receptors are characterized by an extracellular region with a unique cysteine-rich motif extending over its amino-terminal half, followed by two fibronectin type III motifs (PMID: 9530499). They are divided into two sub-groups (EphA and EphB) based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands (PMID: 11114742). EphA4 is involved in commissure formation within the forebrain, axonal guidance in the corticospinal tract, regulation of the central pattern generator that provides normal locomotor function and axonal regeneration following spinal cord injury (PMID: 30061574). EphA4 has been implicated as a disease modifier of amyotrophic lateral sclerosis (ALS) (PMID: 22922411).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16233 Product name: Recombinant human EPHA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 481-603 aa of BC026327 Sequence: KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYE Predict reactive species\nFull Name: EPH receptor A4\nCalculated Molecular Weight: 986 aa, 110 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC026327\nGene Symbol: EPHA4\nGene ID (NCBI): 2043\nRRID: AB_2878936\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P54764\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868917223593,"sku":"21875-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21875-1-ap","provider":"Iright","version":"1.0","type":"link"}