{"product_id":"proteintech-21881-1-ap","title":"Proteintech, 21881-1-AP, ATAD3C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATAD3C (21881-1-AP) by Proteintech is a Polyclonal antibody targeting ATAD3C in WB, ELISA applications with reactivity to human samples\n21881-1-AP targets ATAD3C in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATAD3 (ATPase family AAA Domain-containing protein 3) is a mitochondrial transmembrane protein involved in a variety of cellular processes. ATAD3 contains three isoforms: ATAD3A, ATAD3B and ATAD3C. ATAD3C has a negative dominant role in mitochondrial OXPHOS function and its expression regulates ATAD3A in cells (PMID: 38092275). This antibody can detect ATAD3C.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16422 Product name: Recombinant human ATAD3C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC101211 Sequence: MPEDRTAGRVLAGHGVCLQGRGPDRGHDGRLRARLCPAAPADDALAEGGEAWARGRATLILSPWGDHTSRSLAADPSHPCLCGPAHLGNTPRNKVPRGPHRCVYWLTRGGVWGPLTSPWGQR Predict reactive species\nFull Name: ATPase family, AAA domain containing 3C\nCalculated Molecular Weight: 473 aa, 52 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC101211\nGene Symbol: ATAD3C\nGene ID (NCBI): 219293\nRRID: AB_3669379\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5T2N8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885090394281,"sku":"21881-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21881-1-ap","provider":"Iright","version":"1.0","type":"link"}