{"product_id":"proteintech-21916-1-ap","title":"Proteintech, 21916-1-AP, ONECUT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ONECUT2 (21916-1-AP) by Proteintech is a Polyclonal antibody targeting ONECUT2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n21916-1-AP targets ONECUT2 in WB, IHC, IF, IP, chIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  mouse skin tissue,  HEK-293 cells,  HepG2 cells,  Jurkat cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nONECUT2, also named as One cut domain family member 2 or Hepatocyte nuclear factor 6-beta, is a 504 amino acid protein, which contains one CUT DNA-binding domain and one homeobox DNA-binding domain. ONECUT2 belongs to the CUT homeobox family and activates the transcription of a number of liver genes such as HNF3B. ONECUT2 is required for liver differnetiation and metabolism. ONECUT2 and ONECUT3 play redundant roles with ONECUT1 in pancreas development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16162 Product name: Recombinant human ONECUT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 226-332 aa of BC108925 Sequence: PLAATPLGNGLGGLHNAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPGHTQSHGPVLAPSRERPPSSSSGSQVATSGQLEE Predict reactive species\nFull Name: one cut homeobox 2\nCalculated Molecular Weight: 504 aa, 54 kDa\nObserved Molecular Weight: 54-60 kDa\nGenBank Accession Number: BC108925\nGene Symbol: ONECUT2\nGene ID (NCBI): 9480\nRRID: AB_2848180\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95948\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868876853417,"sku":"21916-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21916-1-ap","provider":"Iright","version":"1.0","type":"link"}