{"product_id":"proteintech-21923-1-ap","title":"Proteintech, 21923-1-AP, ACC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACC1 (21923-1-AP) by Proteintech is a Polyclonal antibody targeting ACC1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat, pig samples\n21923-1-AP targets ACC1 in WB, IHC, IF\/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  PK-15 cells,  HepG2 cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: mouse skeletal muscle tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACACA(Acetyl-CoA carboxylase 1, ACC), also named as ACAC, ACC1 and ACCA, belongs to the biotin containing enzyme family. It catalyzes the synthesis of malonyl-CoA, which is an intermediate substrate playing a pivotal role in the regulation of fatty acid metabolism and energy production. ACACA is involved in the biosynthesis of fatty acids, and malonyl-CoA produced is used as a building block to extend the chain length of fatty acids by fatty acid synthase (FAS)(PMID:19900410). It has 4 isoforms produced by alternative promoter usage with the molecular weight between 260 kDa and 270 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat, pig, chicken, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16452 Product name: Recombinant human ACC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2260-2383 aa of BC137287 Sequence: LLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST Predict reactive species\nFull Name: acetyl-Coenzyme A carboxylase alpha\nCalculated Molecular Weight: 2383 aa, 275 kDa\nObserved Molecular Weight: 250 kDa\nGenBank Accession Number: BC137287\nGene Symbol: Acetyl-CoA Carboxylase 1\nGene ID (NCBI): 31\nRRID: AB_11042445\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13085\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868823998633,"sku":"21923-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21923-1-ap","provider":"Iright","version":"1.0","type":"link"}