{"product_id":"proteintech-21932-1-ap","title":"Proteintech, 21932-1-AP, SLC14A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC14A2 (21932-1-AP) by Proteintech is a Polyclonal antibody targeting SLC14A2 in WB, ELISA applications with reactivity to human, mouse samples\n21932-1-AP targets SLC14A2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC14A2, also known as human urea transporter -2 (HUT2), is the human homolog of UT-A2 and the only kidney-specific urea transporter cloned in humans. Urea transport in the kidney is mediated by a family of transporter proteins, including renal urea transporters (UT-A) and erythrocyte urea transporters (UT-B). UT-A proteins expressed in the kidney play a critical role in generating the hypertonic medulla, which is an integral component of the urinary concentrating mechanism (PMID: 11590132, 11880324). The 4.2-kb hUT-A1 cDNA encodes a 920-amino acid peptide, which is 89% identical to the rat UT-A1 protein (PMID: 11502588).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16561 Product name: Recombinant human SLC14A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 431-610 aa of BC110445 Sequence: EANRIYYLTVKSGEEEKAPSGGGGEHPPTAGPKVEEGSEAVLSKHRSVFHIEWSSIRRRSKVFGKGEHQERQNKDPFPYRYRKPTVELLDLDTMEESSEIKVETNISKTSWIRSSMAASGKRVSKALSYITGEMKECGEGLKDKSPVFQFFDWVLRGTSQVMFVNNPLSGILIILGLFIQ Predict reactive species\nFull Name: solute carrier family 14 (urea transporter), member 2\nCalculated Molecular Weight: 920 aa, 101 kDa\nObserved Molecular Weight: 43 kDa, 101 kDa\nGenBank Accession Number: BC110445\nGene Symbol: SLC14A2\nGene ID (NCBI): 8170\nRRID: AB_3085679\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15849\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887803584681,"sku":"21932-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21932-1-ap","provider":"Iright","version":"1.0","type":"link"}