{"product_id":"proteintech-21944-1-ap","title":"Proteintech, 21944-1-AP, SH3BGRL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SH3BGRL2 (21944-1-AP) by Proteintech is a Polyclonal antibody targeting SH3BGRL2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n21944-1-AP targets SH3BGRL2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse liver tissue,  human placenta tissue\nPositive IHC detected in: human liver tissue, human placenta tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16638 Product name: Recombinant human SH3BGRL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC040489 Sequence: MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDTTMSEEQRQWMYKNVPPEKKPTQGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP Predict reactive species\nFull Name: SH3 domain binding glutamic acid-rich protein like 2\nCalculated Molecular Weight: 107 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC040489\nGene Symbol: SH3BGRL2\nGene ID (NCBI): 83699\nRRID: AB_11182822\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UJC5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869598175401,"sku":"21944-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21944-1-ap","provider":"Iright","version":"1.0","type":"link"}