{"product_id":"proteintech-21978-1-ap","title":"Proteintech, 21978-1-AP, CHRM3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHRM3 (21978-1-AP) by Proteintech is a Polyclonal antibody targeting CHRM3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21978-1-AP targets CHRM3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, mouse brain tissue,  rat brain tissue,  SK-N-SH cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHRM3 (M3 muscarinic acetylcholine receptor) is a major player in many kinds of cancer (PMID: 26175851). The expression of muscarinic receptors, mainly the CHRM3, is amplified in several types of tumors, including colon cancer, prostate cancer, endometrial carcinoma, and gastric cancer. Colon cancer overexpresses CHRM3, and post-M3R signaling promotes cell growth via the activation of the epidermal growth factor receptors\/ERK and protein kinase C\/p38 mitogen-activated protein kinase (MAPK) signaling pathways (PMID: 37744266).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17791 Product name: Recombinant human CHRM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 261-477 aa of BC121026 Sequence: RTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITK Predict reactive species\nFull Name: cholinergic receptor, muscarinic 3\nCalculated Molecular Weight: 590 aa, 66 kDa\nObserved Molecular Weight: 60-66 kDa\nGenBank Accession Number: BC121026\nGene Symbol: CHRM3\nGene ID (NCBI): 1131\nRRID: AB_3085681\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20309\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869655552169,"sku":"21978-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21978-1-ap","provider":"Iright","version":"1.0","type":"link"}