{"product_id":"proteintech-21987-1-ap","title":"Proteintech, 21987-1-AP, TSPAN31 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSPAN31 (21987-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN31 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21987-1-AP targets TSPAN31 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat heart tissue, HeLa cells,  HepG2 cells,  mouse skeletal muscle tissue,  PC-3 cells\nPositive IHC detected in: human skeletal muscle tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTetraspanin-31 (TSPAN31) belongs to the tetraspanin (TM4SF) family, also known as the transmembrane 4 (TM4) superfamily, which is a family of transmembrane proteins with 33 mammalian members. These proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth, and motility. Tetraspanin-31 is thought to be involved in growth-related cellular processes. The experimentally determined molecular mass of 30 kDa is larger than the calculated molecular mass of 23 kDa, which could be a result of post-translational modifications.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17138 Product name: Recombinant human TSPAN31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 91-180 aa of BC010377 Sequence: VISCSCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGL Predict reactive species\nFull Name: tetraspanin 31\nCalculated Molecular Weight: 210 aa, 23 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC010377\nGene Symbol: TSPAN31\nGene ID (NCBI): 6302\nRRID: AB_2878962\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12999\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869623898281,"sku":"21987-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21987-1-ap","provider":"Iright","version":"1.0","type":"link"}