{"product_id":"proteintech-21996-1-ap","title":"Proteintech, 21996-1-AP, OSCAR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OSCAR (21996-1-AP) by Proteintech is a Polyclonal antibody targeting OSCAR in WB, ELISA applications with reactivity to human samples\n21996-1-AP targets OSCAR in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOsteoclast-associated receptor (OSCAR) is an FcRγ-associated receptor that belongs to the leukocyte receptor cluster (LRC). OSCAR is expressed by myeloid cells and is involved in antigen presentation and activation of human dendritic cells(PMID: 15155468; PMID: 15650060). OSCAR is expressed in osteoclast cells and involved in the differentiation of osteoclasts from peripheral blood mononuclear cells (PBMC). The N-glycosylated form of human OSCAR has a molecular weight of approximately 40-45 kDa, while 30 kDa corresponds to its fully non-glycosylated form (PMID: 15155468; 24902903; 27917924)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17366 Product name: Recombinant human OSCAR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-282 aa of BC035023 Sequence: NVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGV Predict reactive species\nFull Name: osteoclast associated, immunoglobulin-like receptor\nCalculated Molecular Weight: 282 aa, 31 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC035023\nGene Symbol: OSCAR\nGene ID (NCBI): 126014\nRRID: AB_3669383\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IYS5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887747223721,"sku":"21996-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21996-1-ap","provider":"Iright","version":"1.0","type":"link"}