{"product_id":"proteintech-22001-1-ap","title":"Proteintech, 22001-1-AP, STRA6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STRA6 (22001-1-AP) by Proteintech is a Polyclonal antibody targeting STRA6 in WB, ELISA applications with reactivity to human, mouse samples\n22001-1-AP targets STRA6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTRA6, also known as MCOPS9 and PP14296. Functions as retinol transporter. Accepts all-trans retinol from the extracellular retinol-binding protein RBP4, facilitates retinol transport across the cell membrane, and then transfers retinol to the cytoplasmic retinol-binding protein RBP1. Contributes to the activation of a signaling cascade that depends on retinol transport and LRAT-dependent generation of retinol metabolites that then trigger activation of JAK2 and its target STAT5, and ultimately increase the expression of SOCS3 and inhibit cellular responses to insulin. (PMID:9452451; 18316031; 22665496; 21368206; 22665496).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17591 Product name: Recombinant human STRA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 527-667 aa of BC025256 Sequence: MVATWRVLLSALYNAIHLGQMDLSLLPPRAATLDPGYYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP Predict reactive species\nFull Name: stimulated by retinoic acid gene 6 homolog (mouse)\nCalculated Molecular Weight: 667 aa, 74 kDa\nObserved Molecular Weight: 73-78 kDa\nGenBank Accession Number: BC025256\nGene Symbol: STRA6\nGene ID (NCBI): 64220\nRRID: AB_11064606\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BX79\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868921450665,"sku":"22001-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22001-1-ap","provider":"Iright","version":"1.0","type":"link"}