{"product_id":"proteintech-22025-1-ap","title":"Proteintech, 22025-1-AP, ARPC5L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARPC5L (22025-1-AP) by Proteintech is a Polyclonal antibody targeting ARPC5L in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n22025-1-AP targets ARPC5L in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  NIH\/3T3 cells,  mouse lung tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARPC5L, also known as ARC16-2, belongs to the ARPC5 family. ARPC5L is involved in Arp2\/3 complex-mediated actin nucleation and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ARPC5L-containing Arp2\/3 complexes are required for the peripheral positioning of nuclei in myofibers (PMID: 28892082). The molecular mass of ARPC5L is 17-20 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16881 Product name: Recombinant human ARPC5L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-153 aa of BC000798 Sequence: MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV Predict reactive species\nFull Name: actin related protein 2\/3 complex, subunit 5-like\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 17-20 kDa\nGenBank Accession Number: BC000798\nGene Symbol: ARPC5L\nGene ID (NCBI): 81873\nRRID: AB_11182273\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BPX5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869639364777,"sku":"22025-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22025-1-ap","provider":"Iright","version":"1.0","type":"link"}