{"product_id":"proteintech-22031-1-ap","title":"Proteintech, 22031-1-AP, Vimentin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Vimentin (22031-1-AP) by Proteintech is a Polyclonal antibody targeting Vimentin in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n22031-1-AP targets Vimentin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, A549 cells,  HEK-293 cells,  mouse heart tissue,  HeLa cells,  Jurkat cells,  rat heart tissue\nPositive IF-P detected in: human kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVimentin, also named as VIM, belongs to the intermediate filament family. Vimentin is class-III intermediate filaments found in various non-epithelial cells, especially mesenchymal cells. Vimentin is important for stabilizing the architecture of the cytoplasm. Monocyte-derived macrophages secrete vimentin into the extracellular space in vitro. Secretion of vimentin was enhanced by the proinflammatory cytokine tumor necrosis factor-alpha (TNFA; 191160) and inhibited by the antiinflammatory cytokine IL10 (124092), suggesting that vimentin is involved in the immune response. Vimentin has specialized functions that contribute to specific dynamic cellular processes. As a phosphoprotein, 55-60 kDa of vimentin proteins can be observed due to the different phosphorylation level. Isoforms of vimentin (49 kDa and 60 kDa) had also been reported. (PMID: 8640945, 22728585).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16898 Product name: Recombinant human Vimentin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC000163 Sequence: MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDF Predict reactive species\nFull Name: vimentin\nCalculated Molecular Weight: 466 aa, 54 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC000163\nGene Symbol: VIM\nGene ID (NCBI): 7431\nENSEMBL Gene ID: ENSG00000026025\nRRID: AB_11182825\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08670\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868863615145,"sku":"22031-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22031-1-ap","provider":"Iright","version":"1.0","type":"link"}