{"product_id":"proteintech-22033-1-ap","title":"Proteintech, 22033-1-AP, SARA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SARA (22033-1-AP) by Proteintech is a Polyclonal antibody targeting SARA in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n22033-1-AP targets SARA in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse brain tissue,  MCF-7 cells,  human brain tissue,  HeLa cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue, mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZFYVE9, also known as SARA (Smad anchor for receptor activation), is a double zinc finger (FYVE domain) protein that interacts directly with SMAD2 and SMAD3, and is involved in Alzheimer's disease. SARA functions to recruit SMAD2\/SMAD3 to intracellular membranes and to the TGF-beta receptor. SARA plays a significant role in TGF-mediated signaling by regulating the subcellular location of SMAD2 and SMAD3 and modulating the transcriptional activity of the SMAD3\/SMAD4 complex. SARA is possibly associated with TGF-beta receptor internalization.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16929 Product name: Recombinant human ZFYVE9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1075-1425 aa of BC032680 Sequence: MLRLGAEYRLYPCPLFSVRFRKPLFGETGHTIMNLLADFRNYQYTLPVVQGLVVDMEVRKTSIKIPSNRYNEMMKAMNKSNEHVLAGGACFNEKADSHLVCVQNDDGNYQTQAISIHNQPRKVTGASFFVFSGALKSSSGYLAKSSIVEDGVMVQITAENMDSLRQALREMKDFTITCGKADAEEPQEHIHIQWVDDDKNVSKGVVSPIDGKSMETITNVKIFHGSEYKANGKVIRWTEVFFLENDDQHNCLSDPADHSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQVGYQAGSNGQPLPSQYMNDLDSALVPVIHGGACQLSEGPVVMELIFYILENIV Predict reactive species\nFull Name: zinc finger, FYVE domain containing 9\nCalculated Molecular Weight: 1425 aa, 156 kDa\nObserved Molecular Weight: 156 kDa\nGenBank Accession Number: BC032680\nGene Symbol: SARA\nGene ID (NCBI): 9372\nRRID: AB_11182938\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95405\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869428699305,"sku":"22033-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22033-1-ap","provider":"Iright","version":"1.0","type":"link"}