{"product_id":"proteintech-22046-1-ap","title":"Proteintech, 22046-1-AP, C5orf4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C5orf4 (22046-1-AP) by Proteintech is a Polyclonal antibody targeting C5orf4 in WB, IHC, ELISA applications with reactivity to human samples\n22046-1-AP targets C5orf4 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells,  A549 cells,  HepG2 cells\nPositive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFatty acid hydroxylase domain containing 2 (FAXDC2), also known as C5orf4, is a 40 kDa protein. The function of FAXDC2 remains largely unknown. The MW of this protein is 25 kDa, and this antibody specially recognises the 25 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16960 Product name: Recombinant human C5orf4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 224-333 aa of BC007216 Sequence: EHAVSNMLPVIVGPLVMGSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTDTMFKQTKAYERHVLLLGFTPLSESIPDSPKRME Predict reactive species\nFull Name: chromosome 5 open reading frame 4\nCalculated Molecular Weight: 333 aa, 39 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC007216\nGene Symbol: C5orf4\nGene ID (NCBI): 10826\nRRID: AB_2878979\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96IV6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869520285865,"sku":"22046-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22046-1-ap","provider":"Iright","version":"1.0","type":"link"}