{"product_id":"proteintech-22051-1-ap","title":"Proteintech, 22051-1-AP, FOXP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FOXP1 (22051-1-AP) by Proteintech is a Polyclonal antibody targeting FOXP1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n22051-1-AP targets FOXP1 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  A549 cells,  LNCaP cells,  MCF-7 cells,  MDA-MB-453s cells,  mouse heart tissue,  mouse lung tissue,  mouse testis tissue,  PC-3 cells,  Raji cells,  Y79 cells\nPositive IHC detected in: mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFOXP1, also known as Mac-1-regulated forkhead, is a 677 amino acid protein, which forms homodimers and heterodimers with FOXP2 and FOXP4 (PubMed:25027557). Dimerization is required for DNA-binding. FOXP1 has an important function in neuronal development.9 Mutations of its gene, FOXP1, located on chromosome 3p14.1,7 can result in the development of autism spectrum disorder, intellectual disability, speech and language deficits as well as motor development delay. FOXP1 is also engaged in lung and esophagus morphogenesis, as well as in B-cell development.7,10 The widely researched role of FOXP1 in carcinogenesis is of great importance, although still unclear to some extent. FOXP1 exists some isoforms with MV 75-77 kDa, 65-67 kDa, 12 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17045 Product name: Recombinant human FOXP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 349-457 aa of BC131720 Sequence: QLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEF Predict reactive species\nFull Name: forkhead box P1\nCalculated Molecular Weight: 677 aa, 75 kDa\nObserved Molecular Weight: 50 kDa, 60-65 kDa, 85 kDa\nGenBank Accession Number: BC131720\nGene Symbol: FOXP1\nGene ID (NCBI): 27086\nRRID: AB_2878980\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H334\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869406974121,"sku":"22051-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22051-1-ap","provider":"Iright","version":"1.0","type":"link"}