{"product_id":"proteintech-22067-1-ap","title":"Proteintech, 22067-1-AP, CDK8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDK8 (22067-1-AP) by Proteintech is a Polyclonal antibody targeting CDK8 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n22067-1-AP targets CDK8 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  NIH\/3T3 cells,  mouse embryo tissue\nPositive IHC detected in: human stomach cancer tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells\nPositive FC (Intra) detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17148 Product name: Recombinant human CDK8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 360-464 aa of BC069634 Sequence: TEEEPDDKGDKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY Predict reactive species\nFull Name: cyclin-dependent kinase 8\nCalculated Molecular Weight: 464 aa, 53 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC069634\nGene Symbol: CDK8\nGene ID (NCBI): 1024\nRRID: AB_2878983\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49336\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868978139305,"sku":"22067-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22067-1-ap","provider":"Iright","version":"1.0","type":"link"}