{"product_id":"proteintech-22109-1-ap","title":"Proteintech, 22109-1-AP, ALDH1A1-specific Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALDH1A1-specific (22109-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH1A1-specific in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n22109-1-AP targets ALDH1A1-specific in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, human liver tissue,  K-562 cells,  HepG2 cells,  mouse liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nALDH1A1(Aldehyde dehydrogenase family 1 member A1 ), also named as ALDC, ALDH1 and PUMB1, belongs to the aldehyde dehydrogenase family. The ALDH1A1 gene encodes a liver cytosolic isoform of acetaldehyde dehydrogenase, an enzyme involved in the major pathway of alcohol metabolism after alcohol dehydrogenase. ALDH1A1 plays a critical role in protection against oxidative stress-induced cytotoxicity in lens epithelial cells(PMID:19296407). And it is important for multiple biological activities including drug resistance, cell differentiation, and oxidative stress response(PMID:19025616). As a novel cancer stem cell marker, ALDH1A1 can be used for tumors whose corresponding normal tissues express ALDH1 in relatively restricted or limited levels such as breast, lung, ovarian or colon cancer(PMID: 20422001). This antibody can also recognize some other membranes of the aldehyde dehydrogenase family. This antibody is specific to ALDH1A1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17358 Product name: Recombinant human ALDH1A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 403-449 aa of BC001505 Sequence: GPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQA Predict reactive species\nFull Name: aldehyde dehydrogenase 1 family, member A1\nCalculated Molecular Weight: 501 aa, 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC001505\nGene Symbol: ALDH1A1\nGene ID (NCBI): 216\nRRID: AB_10949189\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00352\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868947009705,"sku":"22109-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22109-1-ap","provider":"Iright","version":"1.0","type":"link"}