{"product_id":"proteintech-22130-1-ap","title":"Proteintech, 22130-1-AP, TNNI2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TNNI2 (22130-1-AP) by Proteintech is a Polyclonal antibody targeting TNNI2 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n22130-1-AP targets TNNI2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17750 Product name: Recombinant human TNNI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC032148 Sequence: MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDL Predict reactive species\nFull Name: troponin I type 2 (skeletal, fast)\nCalculated Molecular Weight: 182 aa, 21 kDa\nObserved Molecular Weight: 21-26 kDa\nGenBank Accession Number: BC032148\nGene Symbol: TNNI2\nGene ID (NCBI): 7136\nRRID: AB_2879002\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48788\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869437710505,"sku":"22130-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22130-1-ap","provider":"Iright","version":"1.0","type":"link"}