{"product_id":"proteintech-22141-1-ap","title":"Proteintech, 22141-1-AP, FUT4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FUT4 (22141-1-AP) by Proteintech is a Polyclonal antibody targeting FUT4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n22141-1-AP targets FUT4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, A431 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFUT4, also named as ELFT and FCT3A, belongs to the glycosyltransferase 10 family. FUT4 may catalyze alpha-1,3 glycosidic linkages involved in the expression of Lewis X\/SSEA-1 and VIM-2 antigens. The expression of CD15 (acts as a terminal glycotope in glycoproteins and glycolipids) is directed by FUT4 in promyelocytes and monocytes. FUT4 is an antigenic epitope defined as a Lewis X carbohydrate structure is expressed on murine embryonal carcinoma cells (EC), murine ES and iPS cells, and murine and human germ cells. It is widely used as a positive surface marker for mouse undifferentiated ES and iPS cells and a negative surface marker for human undifferentiated ES and iPS cells. Expression is down-regulated following differentiation of murine EC and ES cells, while the differentiation of human EC and ES cells is accompanied by an increase in FUT4 expression. FUT4 is associated with cell adhesion, migration and differentiation. 22141-1-AP detects the band around 45 kDa and glycosylated isoform 63 kDa protein in SDS-PAGE. (PMID: 22287018, 17335083, 11278338)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17565 Product name: Recombinant human FUT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-407 aa of BC136374 Sequence: QLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPLSRKQGLVAWVVSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARY Predict reactive species\nFull Name: fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific)\nCalculated Molecular Weight: 530 aa, 59 kDa\nObserved Molecular Weight: 45 kDa, 63 kDa\nGenBank Accession Number: BC136374\nGene Symbol: FUT4\nGene ID (NCBI): 2526\nRRID: AB_2879006\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22083\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887644561577,"sku":"22141-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22141-1-ap","provider":"Iright","version":"1.0","type":"link"}